Cxxc5 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Cxxc5 may indirectly participate in activation of the NF-kappa-B and MAPK pathways. It acts as a mediator of BMP4-mediated modulation of canonical Wnt signaling activity in neural stem cells. Cxxc5 is also required for DNA damage-induced ATM phosphorylation, p53 activation and cell cycle arrest and is involved in myelopoiesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Cxxc5

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MSSLGGGSQDAGGSSSSSNTNSSSGSGQKAGGTDKSTAVAATTAPTSVAD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: CXXC-type zinc finger protein 5

Protein Size: 317

Purification: Affinity Purified

• Artikelnummer: AVIARP58792_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58792_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 67393
• Wirt: Rabbit
• Konjugat: Conjugated, HRP