CYB5RL Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC606495

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: KLNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPGQHLILRGIVD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NADH-cytochrome b5 reductase-like

Protein Size: 315

Purification: Affinity Purified

• Artikelnummer: AVIARP56230_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56230_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 606495
• Wirt: Rabbit