CYP20A1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein lacks

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CYP20A1

Key Reference: Jiang,J.H., (2004) Ai Zheng 23 (6), 672-677

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: ITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytochrome P450 20A1

Protein Size: 462

Purification: Affinity Purified

• Artikelnummer: AVIARP57758_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57758_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57404
• Wirt: Rabbit