DAPP1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: DAPP1 may act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DAPP1

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: KHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide

Protein Size: 280

Purification: Affinity Purified

• Artikelnummer: AVIARP55042_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55042_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 27071
• Wirt: Rabbit