DAPP1 Antibody - middle region : HRP

DAPP1 Antibody - middle region : HRP
Artikelnummer
AVIARP55041_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: DAPP1 may act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DAPP1

Molecular Weight: 32

Peptide Sequence: Synthetic peptide located within the following region: SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide

Protein Size: 280

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55041_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55041_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27071
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×