DBNDD2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: DBNDD2 may modulate the activity of casein kinase-1. Inhibits CSNK1D autophosphorylation (in vitro). .

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human DBNDD2

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: DPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Dysbindin domain-containing protein 2

Protein Size: 161

Purification: Affinity Purified

• Artikelnummer: AVIARP56283_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56283_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55861
• Wirt: Rabbit