DDI1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DDI1

Key Reference: Puente,X.S. (2004) Genome Res. 14 (4), 609-622

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: KNVLVIGTTGTQTYFLPEGELPLCSRMVSGQDESSDKEITHSVMDSGRKE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein DDI1 homolog 1

Protein Size: 396

Purification: Affinity Purified

• Artikelnummer: AVIARP56142_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56142_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 414301
• Wirt: Rabbit