DMTN Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Dematin, or EPB49, is an actin-bundling protein originally identified in the erythroid membrane skeleton. Its actin-bundling activity is abolished upon phosphorylation by cAMP-dependent protein kinase and is restored after dephosphorylation.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human DMTN

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: KGRTKLPPGVDRMRLERHLSAEDFSRVFAMSPEEFGKLALWKRNELKKKA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Dematin

Protein Size: 383

Purification: Affinity Purified

• Artikelnummer: AVIARP58695_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58695_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2039
• Wirt: Rabbit
• Konjugat: Conjugated, HRP