DNAJA4 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human DNAJA4

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: EKGILIIQFLVIFPEKHWLSLEKLPQLEALLPPRQKVRITDDMDQVELKE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: dnaJ homolog subfamily A member 4

Protein Size: 181

Purification: Affinity Purified

• Artikelnummer: AVIARP57276_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57276_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55466
• Wirt: Rabbit