DOG-1 / TMEM16A (Marker for Gastrointestinal Stromal Tumors); Clone DG1/447 & DOG-1.1 (Concentrate)

Specificity: This monoclonal antibody recognizes Human DOG1. It is a sensitive and specific immunohistochemical marker for GIST, comparable with c-Kit, with the additional benefit of detecting c-Kit-negative GISTs. It is also a sensitive marker for unusual GIST subgroups lacking c-Kit or PDGFRA mutations.
Immunogen: Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).

• Artikelnummer: SCYRA0364-C.5
• Hersteller: ScyTek Laboratories
• Hersteller Artikelnummer: RA0364-C.5
• Verpackungseinheit: 0,5 ml
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Isotyp: IgG1
• Wirt: Mouse