DPPA3 Antibody - N-terminal region : HRP

DPPA3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58824_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein that in mice may function as a maternal factor during the preimplantation stage of development. In mice, this gene may play a role in transcriptional repression, cell division, and maintenance of cell pluripotentiality. In humans, related intronless loci are located on chromosomes 14 and X.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DPPA3

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: DPSQFNPTYIPGSPQMLTEENSRDDSGASQISSETLIKNLSNLTINASSE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Developmental pluripotency-associated protein 3

Protein Size: 159

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58824_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58824_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 359787
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×