DPPA5 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: DPPA5 is involved in the maintenance of embryonic stem (ES) cell pluripotency. DPPA5 is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. DPPA5 is associates with specific target mRNAs.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DPPA5

Key Reference: Pierre,A., (2007) Genomics 90 (5), 583-594

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Developmental pluripotency-associated 5 protein

Protein Size: 116

Purification: Affinity Purified

• Artikelnummer: AVIARP58746_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58746_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 340168
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin