DPY19L2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The exact functions of DPY19L2 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DPY19L2

Key Reference: Carson,A.R., (er) BMC Genomics 7, 45 (2006)

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein dpy-19 homolog 2

Protein Size: 758

Purification: Affinity Purified

• Artikelnummer: AVIARP55709_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55709_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 283417
• Wirt: Rabbit