DPY19L2 Antibody - middle region : FITC

DPY19L2 Antibody - middle region : FITC
Artikelnummer
AVIARP55709_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact functions of DPY19L2 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DPY19L2

Key Reference: Carson,A.R., (er) BMC Genomics 7, 45 (2006)

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein dpy-19 homolog 2

Protein Size: 758

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55709_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55709_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 283417
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×