DRAM Antibody - N-terminal region : Biotin

DRAM Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58891_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene is regulated as part of the p53 tumor suppressor pathway. The gene encodes a lysosomal membrane protein that is required for the induction of autophagy by the pathway. Decreased transcriptional expression of this gene is associated with various tumors. This gene has a pseudogene on chromosome 4.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DRAM

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: TMYTRYKIVQKQNQTCYFSTPVFNLVSLVLGLVGCFGMGIVANFQELAVP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA damage-regulated autophagy modulator protein 1

Protein Size: 238

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58891_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58891_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55332
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×