DRAM Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is regulated as part of the p53 tumor suppressor pathway. The gene encodes a lysosomal membrane protein that is required for the induction of autophagy by the pathway. Decreased transcriptional expression of this gene is associated with various tumors. This gene has a pseudogene on chromosome 4.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DRAM

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: TMYTRYKIVQKQNQTCYFSTPVFNLVSLVLGLVGCFGMGIVANFQELAVP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA damage-regulated autophagy modulator protein 1

Protein Size: 238

Purification: Affinity Purified

• Artikelnummer: AVIARP58891_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58891_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55332
• Wirt: Rabbit
• Konjugat: Conjugated, FITC