DUSP22 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: DUSP22 activates the Jnk signaling pathway. It dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK).

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DUSP22

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: LPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Dual specificity protein phosphatase 22

Protein Size: 184

Purification: Affinity Purified

• Artikelnummer: AVIARP58456_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58456_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 56940
• Wirt: Rabbit
• Konjugat: Conjugated, HRP