Eapp Antibody - N-terminal region : Biotin

Eapp Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57255_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Eapp

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: PALSSSEDEVDVLLHGTPDQKRKLIRECLTGESESSEDEFEKEMEAELNS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Eapp protein EMBL AAI68880.1

Protein Size: 280

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57255_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57255_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 299043
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×