EFHD2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: EFHD2 may regulate B-cell receptor (BCR)-induced immature and primary B-cell apoptosis. It plays a role as negative regulator of the canonical NF-kappa-B-activating branch. EFHD2 controls spontaneous apoptosis through the regulation of BCL2L1 abundance.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EFHD2

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: EF-hand domain-containing protein D2

Protein Size: 240

Purification: Affinity Purified

• Artikelnummer: AVIARP58617_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58617_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Zebrafish, Yeast
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 79180
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin