English
EFHD2 Antibody - N-terminal region : HRP
EFHD2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58617_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: EFHD2 may regulate B-cell receptor (BCR)-induced immature and primary B-cell apoptosis. It plays a role as negative regulator of the canonical NF-kappa-B-activating branch. EFHD2 controls spontaneous apoptosis through the regulation of BCL2L1 abundance.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EFHD2
Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648
Molecular Weight: 26kDa
Peptide Sequence: Synthetic peptide located within the following region: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: EF-hand domain-containing protein D2
Protein Size: 240
Purification: Affinity Purified
Description of Target: EFHD2 may regulate B-cell receptor (BCR)-induced immature and primary B-cell apoptosis. It plays a role as negative regulator of the canonical NF-kappa-B-activating branch. EFHD2 controls spontaneous apoptosis through the regulation of BCL2L1 abundance.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EFHD2
Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648
Molecular Weight: 26kDa
Peptide Sequence: Synthetic peptide located within the following region: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: EF-hand domain-containing protein D2
Protein Size: 240
Purification: Affinity Purified
| Artikelnummer | AVIARP58617_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58617_P050-HRP |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Zebrafish, Yeast |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 79180 |
| Wirt | Rabbit |
| Konjugat | Conjugated, HRP |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
