EGR1 Antibody - middle region : Biotin

EGR1 Antibody - middle region : Biotin
Artikelnummer
AVIARP58382_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a tr

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EGR1

Key Reference: Akutagawa,O., (2008) Cancer Sci. 99 (7), 1401-1406

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Early growth response protein 1

Protein Size: 543

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58382_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58382_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 1958
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×