EIF2C3 Antibody - N-terminal region : FITC

EIF2C3 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58813_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: EIF2C3 is a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing. This gene is

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF2C3

Key Reference: Sasaki,T., (2003) Genomics 82 (3), 323-330

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein argonaute-3

Protein Size: 626

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58813_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58813_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 192669
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×