Eif4e Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Eif4e binds to the mRNA 7-methylguanosine cap and mediates mRNA binding to the 40S ribosome in the rate limiting step in translational initiation.

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: TTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Eukaryotic translation initiation factor 4E

Protein Size: 217

Purification: Affinity Purified

• Artikelnummer: AVIARP58894_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58894_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 117045
• Wirt: Rabbit
• Konjugat: Conjugated, FITC