Eif4e Antibody - C-terminal region : HRP

Eif4e Antibody - C-terminal region : HRP
Artikelnummer
AVIARP58894_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Eif4e binds to the mRNA 7-methylguanosine cap and mediates mRNA binding to the 40S ribosome in the rate limiting step in translational initiation.

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: TTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Eukaryotic translation initiation factor 4E

Protein Size: 217

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58894_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58894_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 117045
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×