EIF4E2 Antibody - N-terminal region : FITC

EIF4E2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58898_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: EIF4E2 belongs to the eukaryotic initiation factor 4E family. It recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF4E2

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: YTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Eukaryotic translation initiation factor 4E type 2

Protein Size: 245

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58898_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58898_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 9470
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×