EIF4E2 Antibody - N-terminal region : HRP

EIF4E2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58897_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: EIF4E2 belongs to the eukaryotic initiation factor 4E family. It recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF4E2

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Eukaryotic translation initiation factor 4E type 2

Protein Size: 245

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58897_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58897_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 9470
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×