Elf2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Elf2

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: TCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: E74-like factor 2 EMBL AAH83598.1

Protein Size: 519

Purification: Affinity Purified

• Artikelnummer: AVIARP57859_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57859_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 361944
• Wirt: Rabbit