ELP2 Antibody - middle region : Biotin

ELP2 Antibody - middle region : Biotin
Artikelnummer
AVIARP57179_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ELP2 regulates the ligand-dependent activation of STAT3. ELP2 acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ELP2

Molecular Weight: 92kDa

Peptide Sequence: Synthetic peptide located within the following region: EESGVWLEQVRVGEVGGNTLGFYDCQFNEDGSMIIAHAFHGALHLWKQNT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Elongator complex protein 2

Protein Size: 826

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57179_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57179_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55250
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×