ERAS Antibody - middle region : Biotin

ERAS Antibody - middle region : Biotin
Artikelnummer
AVIARP55794_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. ERAS plays an important role in the tumor-like growth properties of embryonic stem cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERAS

Key Reference: Miyamoto,S., (2008) Carcinogenesis 29 (2), 418-426

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: AQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTPase ERas

Protein Size: 233

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55794_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55794_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3266
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×