English
ERCC8 Antibody - middle region : Biotin
ERCC8 Antibody - middle region : Biotin
Artikelnummer
AVIARP58570_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: ERCC8 is a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS). This gene encodes a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS). CS cells are abnormally sensitive to ultraviolet radiation and are defective in the repair of transcriptionally active genes.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERCC8
Key Reference: Bethke,L., (2008) J. Natl. Cancer Inst. 100 (4), 270-276
Molecular Weight: 44kDa
Peptide Sequence: Synthetic peptide located within the following region: FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: DNA excision repair protein ERCC-8
Protein Size: 396
Purification: Affinity Purified
Description of Target: ERCC8 is a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS). This gene encodes a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS). CS cells are abnormally sensitive to ultraviolet radiation and are defective in the repair of transcriptionally active genes.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERCC8
Key Reference: Bethke,L., (2008) J. Natl. Cancer Inst. 100 (4), 270-276
Molecular Weight: 44kDa
Peptide Sequence: Synthetic peptide located within the following region: FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: DNA excision repair protein ERCC-8
Protein Size: 396
Purification: Affinity Purified
| Artikelnummer | AVIARP58570_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58570_P050-Biotin |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 1161 |
| Wirt | Rabbit |
| Konjugat | Conjugated, Biotin |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
