ERCC8 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ERCC8 is a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERCC8

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DNA excision repair protein ERCC-8

Protein Size: 396

Purification: Affinity Purified

• Artikelnummer: AVIARP58571_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58571_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 1161
• Wirt: Rabbit
• Konjugat: Conjugated, HRP