ERLIN2 Antibody - middle region : Biotin

ERLIN2 Antibody - middle region : Biotin
Artikelnummer
AVIARP58461_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ERLIN2 plays an important role in the early steps of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is involved in ITPR1 degradation by the ERAD pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERLIN2

Key Reference: Pearce,M.M., (2007) J. Biol. Chem. 282 (28), 20104-20115

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Erlin-2

Protein Size: 339

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58461_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58461_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 11160
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×