ERLIN2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ERLIN2 plays an important role in the early steps of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is involved in ITPR1 degradation by the ERAD pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERLIN2

Key Reference: Pearce,M.M., (2007) J. Biol. Chem. 282 (28), 20104-20115

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Erlin-2

Protein Size: 339

Purification: Affinity Purified

• Artikelnummer: AVIARP58461_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58461_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 11160
• Wirt: Rabbit
• Konjugat: Conjugated, HRP