ETFB Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ETFB is the electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ETFB

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: PQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYAT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Electron transfer flavoprotein subunit beta

Protein Size: 255

Purification: Affinity Purified

• Artikelnummer: AVIARP54441_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54441_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2109
• Wirt: Rabbit