EVI1 Antibody - middle region : Biotin

EVI1 Antibody - middle region : Biotin
Artikelnummer
AVIARP58568_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EVI1

Key Reference: Sato,T., (2008) Cancer Sci. 99 (7), 1407-1413

Molecular Weight: 118kDa

Peptide Sequence: Synthetic peptide located within the following region: KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MDS1 and EVI1 complex locus protein EVI1

Protein Size: 1051

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58568_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58568_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2122
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×