EVI1 Antibody - middle region : FITC

EVI1 Antibody - middle region : FITC
Artikelnummer
AVIARP58566_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EVI1

Molecular Weight: 118kDa

Peptide Sequence: Synthetic peptide located within the following region: KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MDS1 and EVI1 complex locus protein EVI1

Protein Size: 1051

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58566_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58566_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2122
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×