EVI1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EVI1

Key Reference: Sato,T., (2008) Cancer Sci. 99 (7), 1407-1413

Molecular Weight: 118kDa

Peptide Sequence: Synthetic peptide located within the following region: KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: MDS1 and EVI1 complex locus protein EVI1

Protein Size: 1051

Purification: Affinity Purified

• Artikelnummer: AVIARP58568_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58568_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2122
• Wirt: Rabbit
• Konjugat: Conjugated, HRP