EVI1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EVI1

Key Reference: Sato,T., (2008) Cancer Sci. 99 (7), 1407-1413

Molecular Weight: 118kDa

Peptide Sequence: Synthetic peptide located within the following region: VKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKHPSVGDNKPVELQP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MDS1 and EVI1 complex locus protein EVI1

Protein Size: 1051

Purification: Affinity Purified

• Artikelnummer: AVIARP58384_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58384_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2122
• Wirt: Rabbit
• Konjugat: Conjugated, FITC