EXOC4 Antibody - N-terminal region : HRP

EXOC4 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56253_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EXOC4

Key Reference: Pohl,C. (2008) Cell 132 (5), 832-845

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: EXOC4 protein EMBL AAH26174.1

Protein Size: 473

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56253_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56253_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 60412
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×