FAM80A Antibody - middle region : HRP

FAM80A Antibody - middle region : HRP
Artikelnummer
AVIARP55677_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of FAM80A is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM80A

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: EAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: N-acetylaspartyl-glutamate synthetase A

Protein Size: 350

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55677_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55677_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 284716
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×