FAM90A1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: FAM90A1 belongs to subfamily I of the primate-specific FAM90A gene family, which originated from multiple duplications and rearrangements (Bosch et al., 2007 [PubMed 17684299]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM90A1

Key Reference: 0

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: PDEEDPRLKCKNCEAFGHTARSTRCPMKCWKAALVPPNFGEKEGKENLKP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM90A1

Protein Size: 464

Purification: Affinity Purified

• Artikelnummer: AVIARP57109_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57109_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55138
• Wirt: Rabbit