FAS Antibody - N-terminal region : Biotin

FAS Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP59115_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: FAS is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. At least eight alternatively spliced transcript variants encoding seven distinct isoforms have been described. The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAS

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: GLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tumor necrosis factor receptor superfamily member 6

Protein Size: 335

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59115_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59115_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Goat (Caprine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 355
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×