English
FBXL4 Antibody - N-terminal region : FITC
FBXL4 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54856_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains at least 9 tandem leucine-rich repeats.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FBXL4
Molecular Weight: 70kDa
Peptide Sequence: Synthetic peptide located within the following region: VLETYHPGAVIRILACSANPYSPNPPAEVRWEILWSERPTKVNASQARQF
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: F-box/LRR-repeat protein 4
Protein Size: 621
Purification: Affinity Purified
Description of Target: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains at least 9 tandem leucine-rich repeats.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FBXL4
Molecular Weight: 70kDa
Peptide Sequence: Synthetic peptide located within the following region: VLETYHPGAVIRILACSANPYSPNPPAEVRWEILWSERPTKVNASQARQF
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: F-box/LRR-repeat protein 4
Protein Size: 621
Purification: Affinity Purified
| Artikelnummer | AVIARP54856_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP54856_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 26235 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
