English
FBXO10 Antibody - C-terminal region : Biotin
FBXO10 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP54858_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: Members of the F-box protein family, such as FBXO10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FBX10
Key Reference: N/A
Molecular Weight: 105kDa
Peptide Sequence: Synthetic peptide located within the following region: SDTWRLVNPPARPHLENSLRRPSAAHNGQKVTAMATRITARVEGGYHSNR
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: F-box only protein 10
Protein Size: 956
Purification: Affinity purified
Description of Target: Members of the F-box protein family, such as FBXO10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FBX10
Key Reference: N/A
Molecular Weight: 105kDa
Peptide Sequence: Synthetic peptide located within the following region: SDTWRLVNPPARPHLENSLRRPSAAHNGQKVTAMATRITARVEGGYHSNR
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: F-box only protein 10
Protein Size: 956
Purification: Affinity purified
| Artikelnummer | AVIARP54858_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP54858_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 26267 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
