FBXO33 Antibody - middle region : HRP

FBXO33 Antibody - middle region : HRP
Artikelnummer
AVIARP55943_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: FBXO33 is the substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. FBXO33 probably recognizes and binds to phosphorylated target proteins. Recognizes YBX1.Members of the F-box protein family, such as FBXO33, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FBXO33

Key Reference: Jin,J., (2004) Genes Dev. 18 (21), 2573-2580

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: VIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: F-box only protein 33

Protein Size: 555

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55943_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55943_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 254170
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×