Fbxw4 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of Fbxw4 remains unknow.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: STFYCLQTDGNHLLATGSSYYGLVRLWDRRQRACLHAFPLTSTPLSSPVY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: F-box and WD-40 domain protein 4 (Predicted) EMBL EDL94311.1

Protein Size: 408

Purification: Affinity Purified

• Artikelnummer: AVIARP57578_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57578_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 309444
• Wirt: Rabbit