FBXW8 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: FBXW8 is a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXW8 contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FBXW8

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: RNADLDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: F-box/WD repeat-containing protein 8

Protein Size: 598

Purification: Affinity Purified

• Artikelnummer: AVIARP55586_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55586_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 26259
• Wirt: Rabbit