FES Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: FES is the human cellular counterpart of a feline sarcoma retrovirus protein with transforming capabilities. FES has tyrosine-specific protein kinase activity and that activity is required for maintenance of cellular transformation. Its chromosomal location has linked it to a specific translocation event identified in patients with acute promyelocytic leukemia but it is also involved in normal hematopoiesis.

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: EGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQSRAISPDSPISQTHSQDI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tyrosine-protein kinase Fes/Fps

Protein Size: 764

Purification: Affinity Purified

• Artikelnummer: AVIARP54607_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54607_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2242
• Wirt: Rabbit