FGF11 Antibody - N-terminal region : Biotin

FGF11 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54709_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this gene has not yet been determined. The expression pattern of the mouse homolog implies a role in nervous system development.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FGF11

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Fibroblast growth factor 11

Protein Size: 225

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54709_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54709_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2256
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×