FGF13 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located in a region on chromosome X, which is associated with Borjeson-Forssman-Lehmann syndrome (BFLS), making it a possible candidate gene for familial cases of the BFLS, and for other syndromal and nonspecific forms of X-linked mental retardation mapping to this region. Alternative splicing of this gene at the 5' end results in several transcript variants encoding different isoforms with different N-termini.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FGF13

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: PKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Fibroblast growth factor 13

Protein Size: 192

Purification: Affinity Purified

• Artikelnummer: AVIARP55413_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55413_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2258
• Wirt: Rabbit